PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G015200.1.p
Common NamePRUPE_ppa008461mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TALE
Protein Properties Length: 331aa    MW: 37080.7 Da    PI: 6.789
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G015200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092572912155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps++++  LA+++gL+++q+ +WF N+R ++
  Prupe.4G015200.1.p 257 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 291
                         569*****************************885 PP

2ELK41.33.3e-14211232122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlrKYsgyLgsLkqEF+
  Prupe.4G015200.1.p 211 ELKGQLLRKYSGYLGSLKQEFM 232
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.7E-1968112IPR005540KNOX1
PfamPF037903.5E-2270108IPR005540KNOX1
SMARTSM012567.9E-27122173IPR005541KNOX2
PfamPF037912.0E-21126172IPR005541KNOX2
SMARTSM011882.8E-8211232IPR005539ELK domain
PROSITE profilePS5121311.174211231IPR005539ELK domain
PfamPF037895.3E-11211232IPR005539ELK domain
PROSITE profilePS5007112.989231294IPR001356Homeobox domain
SMARTSM003897.4E-13233298IPR001356Homeobox domain
SuperFamilySSF466898.98E-20233309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28236296IPR009057Homeodomain-like
CDDcd000865.42E-12243295No hitNo description
PfamPF059205.7E-17251290IPR008422Homeobox KN domain
PROSITE patternPS000270269292IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQTQTPLLRF SFPSYLHPTT TAIAAPPLSF STDHHPNNNN NNHPAAAAAC YFMDNNNSNH  60
DGSSSSSSSV KAKIMAHPHY HRLLASYINC QKVGAPPEVV ARLEEACASA ASIGQMMSSS  120
SGSGCLGEDP ALDQFMEAYC EMLTKYEQEL SKPFKEAMIF LQRIESQFKA LTLSSSSDSA  180
VCGDGLDRNG SSEEEVDVNN NFIDPQAEDR ELKGQLLRKY SGYLGSLKQE FMKKRKKGKL  240
PKEARQQLLD WWSRHYKWPY PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF  300
VVMDATHPGH YYMDTVLGNP FPMDISPTLL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226235LKQEFMKKRK
2232236KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3642320.0DQ364232.1 Prunus dulcis homeodomain protein Kn1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007213815.10.0hypothetical protein PRUPE_ppa008461mg
SwissprotP466081e-149HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLM5WMU50.0M5WMU5_PRUPE; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-142KNOX/ELK homeobox transcription factor